PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe0069s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 153aa    MW: 18099.4 Da    PI: 7.5087
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe0069s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.5e-2166119356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t+eq++ Le+ Fe ++++  +++++LAkklgL+ rqV vWFqNrRa++k
  Aqcoe0069s0001.1.p  66 KKRRLTSEQVHLLEKSFETENKLEPDRKTQLAKKLGLQPRQVAVWFQNRRARWK 119
                         56789************************************************9 PP

2HD-ZIP_I/II133.11e-4265152188
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                         ekkrrl++eqv+lLE+sFe+e+kLep+rK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l+++ + + ke+e+L+
  Aqcoe0069s0001.1.p  65 EKKRRLTSEQVHLLEKSFETENKLEPDRKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKASYDSLRSDYDDIVKENEKLK 152
                         69************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.91261121IPR001356Homeobox domain
SMARTSM003895.0E-2064125IPR001356Homeobox domain
SuperFamilySSF466893.64E-2066131IPR009057Homeodomain-like
PfamPF000464.3E-1866119IPR001356Homeobox domain
CDDcd000861.09E-1666122No hitNo description
Gene3DG3DSA:1.10.10.607.4E-2367128IPR009057Homeodomain-like
PRINTSPR000311.7E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000311.7E-6101117IPR000047Helix-turn-helix motif
PfamPF021831.4E-13121153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MDSTTSRLFF DGSCHGNMLL LGSGDPVLRG SRSFINMEDS LKRRPFYSSS DELIEEEFYD  60
EQLPEKKRRL TSEQVHLLEK SFETENKLEP DRKTQLAKKL GLQPRQVAVW FQNRRARWKT  120
KQLERDYDLL KASYDSLRSD YDDIVKENEK LKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251293.12e-83PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_010251294.12e-83PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022835e-68HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A061EJ861e-82A0A061EJ86_THECC; Homeobox-leucine zipper protein HAT5
STRINGSolyc02g086930.2.16e-78(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-69homeobox 1